PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00090639001
Common NameGSBRNA2T00090639001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 328aa    MW: 37133.9 Da    PI: 7.4319
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00090639001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.84.3e-3776135261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          ++k+l+cprC+s++tkfCyynny++sqPr+fC++C+ryWt GG++r vPvG+grrknk +
  GSBRNA2T00090639001  76 PDKILPCPRCNSSDTKFCYYNNYNVSQPRHFCRSCQRYWTSGGTMRIVPVGSGRRKNKGW 135
                          7899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3072133IPR003851Zinc finger, Dof-type
PfamPF027012.3E-3178133IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.10880134IPR003851Zinc finger, Dof-type
PROSITE patternPS01361082118IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MSELIDTPVK LFGWTITSSL SLTNNQSATD NIEQASTSLQ RSSDLTEESK ETSENSEITT  60
TTTTSEEKTT DDLKKPDKIL PCPRCNSSDT KFCYYNNYNV SQPRHFCRSC QRYWTSGGTM  120
RIVPVGSGRR KNKGWVSTHH YMHTENTRSS EKILSFDSSG EESLVTENGK NQSSDSVSRD  180
FNNFQRFLPP QVTSSVSPPW PYPAFYHIPV YWGCTVPFWS TLQTSTCLGK RTRDEASHVS  240
VGENEDTSVR ARLDSQSRSN NDEANVATKN RVFYPVPMKR EKTQQFNLFV NESETKSGNN  300
RFVPETYLNL QANPAAMSRS MNFRESM*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00090639001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0065352e-72AC006535.7 Genomic sequence for Arabidopsis thaliana BAC T24P13 from chromosome I, complete sequence.
GenBankCP0026842e-72CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009115413.10.0PREDICTED: dof zinc finger protein DOF1.3-like
SwissprotQ9LQX41e-147DOF13_ARATH; Dof zinc finger protein DOF1.3
TrEMBLA0A078FUW30.0A0A078FUW3_BRANA; BnaA09g29270D protein
TrEMBLM4E7C80.0M4E7C8_BRARP; Uncharacterized protein
STRINGBra024683.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM140821624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26790.11e-135Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]